PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT02062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 268aa    MW: 29630.1 Da    PI: 6.2599
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT02062genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-15109152146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+vd+  ++G++ W++I r+++ gRt++++k++w++
         EMT02062 109 RGNITPEEHLLIVDLQGRWGNR-WSKIVRHLP-GRTDNEIKNFWRT 152
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM00717359105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-1185115IPR009057Homeodomain-like
PROSITE profilePS500904.47289103IPR017877Myb-like domain
SuperFamilySSF466891.75E-1989159IPR009057Homeodomain-like
PROSITE profilePS5129422.626104158IPR017930Myb domain
SMARTSM007171.0E-12108156IPR001005SANT/Myb domain
PfamPF002491.1E-12109152IPR001005SANT/Myb domain
CDDcd001671.52E-10113152No hitNo description
Gene3DG3DSA:1.10.10.604.0E-16116153IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MPPCRRLRSE PFLTPESRLE LLEQIRARRD AQIATGLPPD PLHPEEEKVE EDEEDFEEEG  60
DKPKEEDAGT LATRICRRSS RPSSIPGLNR TGKSCRLRWL NYLRPDVRRG NITPEEHLLI  120
VDLQGRWGNR WSKIVRHLPG RTDNEIKNFW RTKIQKKRRA GATASDSAGC QLLSSTAVTE  180
SQSSSSNSVV RPGGMPHYDV VAATTQPGGW GDHQLGYAVQ GGGVAACAGG MDAGVPPEFL  240
QAAAVAADNF WGLEEFWPTV PPSLHGDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-159015740107B-MYB
1gv2_A7e-159015737104MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-149015791158MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-149015791158MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-149015760127MYB TRANSFORMING PROTEIN
1mse_C8e-159015737104C-Myb DNA-Binding Domain
1msf_C8e-159015737104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655601.28e-52PREDICTED: myb-related protein 340-like
TrEMBLR7W3C30.0R7W3C3_AEGTA; Transcription factor MYB21
STRINGMLOC_68593.11e-67(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.14e-41myb domain protein 21